Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein Galectin-1 [100925] (5 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [190017] (3 PDB entries) |
Domain d3m2ma_: 3m2m A: [180754] automated match to d1w6ma_ |
PDB Entry: 3m2m (more details), 2.95 Å
SCOPe Domain Sequences for d3m2ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m2ma_ b.29.1.3 (A:) Galectin-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} glvasnlnlkpgeclkvrgelapdaksfvlnlgkdsnnlclhfnprfnahgdantivcns kddgtwgteqretafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainymaa dgdfkikcvafe
Timeline for d3m2ma_: