Lineage for d3m2lb_ (3m2l B:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1455550Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 1455551Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 1455552Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF07968
  6. 1455553Protein Alpha-hemolysin [56961] (1 species)
  7. 1455554Species Staphylococcus aureus [TaxId:1280] [56962] (5 PDB entries)
  8. 1455570Domain d3m2lb_: 3m2l B: [180748]
    automated match to d7ahla_
    mutant

Details for d3m2lb_

PDB Entry: 3m2l (more details), 2.1 Å

PDB Description: crystal structure of the m113f mutant of alpha-hemolysin
PDB Compounds: (B:) alpha-hemolysin

SCOPe Domain Sequences for d3m2lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m2lb_ f.6.1.1 (B:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeyfstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

SCOPe Domain Coordinates for d3m2lb_:

Click to download the PDB-style file with coordinates for d3m2lb_.
(The format of our PDB-style files is described here.)

Timeline for d3m2lb_: