![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.1: CCP-like [48114] (5 proteins) |
![]() | Protein automated matches [190089] (9 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (23 PDB entries) |
![]() | Domain d3m2ga_: 3m2g A: [180742] automated match to d1ebea_ complexed with hem, po4 |
PDB Entry: 3m2g (more details), 1.4 Å
SCOPe Domain Sequences for d3m2ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m2ga_ a.93.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk rsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
Timeline for d3m2ga_: