Lineage for d3m2fa_ (3m2f A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919407Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 919408Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 919409Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 919665Protein automated matches [190089] (4 species)
    not a true protein
  7. 919666Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (19 PDB entries)
  8. 919671Domain d3m2fa_: 3m2f A: [180741]
    automated match to d1ebea_
    complexed with hem, po4

Details for d3m2fa_

PDB Entry: 3m2f (more details), 1.4 Å

PDB Description: crystallographic and single crystal spectral analysis of the peroxidase ferryl intermediate
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d3m2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m2fa_ a.93.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
rsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d3m2fa_:

Click to download the PDB-style file with coordinates for d3m2fa_.
(The format of our PDB-style files is described here.)

Timeline for d3m2fa_: