Lineage for d3m2ea_ (3m2e A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720315Protein automated matches [190089] (9 species)
    not a true protein
  7. 2720316Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (23 PDB entries)
  8. 2720326Domain d3m2ea_: 3m2e A: [180740]
    automated match to d1ebea_
    complexed with hem, po4

Details for d3m2ea_

PDB Entry: 3m2e (more details), 1.4 Å

PDB Description: crystallographic and single crystal spectral analysis of the peroxidase ferryl intermediate
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d3m2ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m2ea_ a.93.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
rsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d3m2ea_:

Click to download the PDB-style file with coordinates for d3m2ea_.
(The format of our PDB-style files is described here.)

Timeline for d3m2ea_: