SCOPe 2.01: Domain d3m2aa_: 3m2a A:

Lineage for d3m2aa_ (3m2a A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein automated matches [190089] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (19 PDB entries)

8. Domain d3m2aa_: 3m2a A: [180736]
   automated match to d1ebea_
   complexed with hem, po4

Details for d3m2aa_

PDB Entry: 3m2a, 1.4 Å

PDB Description: crystallographic and single crystal spectral analysis of the peroxidase ferryl intermediate

PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d3m2aa_:

Sequence; same for both SEQRES and ATOM records:

>d3m2aa_ a.93.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk
rsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d3m2aa_:

• d3m2aa_ is new in SCOPe 2.01-stable
  
• d3m2aa_ appears in SCOPe 2.02
  
• d3m2aa_ appears in the current release, SCOPe 2.08