Lineage for d3m1yd_ (3m1y D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1629211Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1629212Protein automated matches [190447] (45 species)
    not a true protein
  7. 1629428Species Helicobacter pylori [TaxId:210] [189290] (1 PDB entry)
  8. 1629432Domain d3m1yd_: 3m1y D: [180728]
    automated match to d1f5sa_
    complexed with cl, mg

Details for d3m1yd_

PDB Entry: 3m1y (more details), 2.4 Å

PDB Description: crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori
PDB Compounds: (D:) Phosphoserine phosphatase (SerB)

SCOPe Domain Sequences for d3m1yd_:

Sequence, based on SEQRES records: (download)

>d3m1yd_ c.108.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 210]}
slqklavfdfdstlvnaetieslarawgvfdevktitlkamngetdfhkslilrvsklkn
mplklakevceslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsnt
livendalnglvtghmmfshskgemllvlqrllnisktntlvvgdgandlsmfkhahiki
afnakevlkqhathcinepdlalikpl

Sequence, based on observed residues (ATOM records): (download)

>d3m1yd_ c.108.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 210]}
slqklavfdfdstlvnaetieslarawgvfdevktitlkamnetdfhkslilrvsklknm
plklakevceslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsntl
ivendalnglvtghmmfshskgemllvlqrllnisktntlvvgdgandlsmfkhahikia
fnakevlkqhathcinepdlalikpl

SCOPe Domain Coordinates for d3m1yd_:

Click to download the PDB-style file with coordinates for d3m1yd_.
(The format of our PDB-style files is described here.)

Timeline for d3m1yd_: