Lineage for d3m1yc_ (3m1y C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1393810Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1393811Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1394417Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1394418Protein automated matches [190447] (43 species)
    not a true protein
  7. 1394609Species Helicobacter pylori [TaxId:210] [189290] (1 PDB entry)
  8. 1394612Domain d3m1yc_: 3m1y C: [180727]
    automated match to d1f5sa_
    complexed with cl, mg

Details for d3m1yc_

PDB Entry: 3m1y (more details), 2.4 Å

PDB Description: Crystal Structure of a Phosphoserine phosphatase (SerB) from Helicobacter pylori
PDB Compounds: (C:) Phosphoserine phosphatase (SerB)

SCOPe Domain Sequences for d3m1yc_:

Sequence, based on SEQRES records: (download)

>d3m1yc_ c.108.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 210]}
slqklavfdfdstlvnaetieslarawgvfdevktitlkamngetdfhkslilrvsklkn
mplklakevceslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsnt
livendalnglvtghmmfshskgemllvlqrllnisktntlvvgdgandlsmfkhahiki
afnakevlkqhathcinepdlalikplie

Sequence, based on observed residues (ATOM records): (download)

>d3m1yc_ c.108.1.0 (C:) automated matches {Helicobacter pylori [TaxId: 210]}
slqklavfdfdstlvnaetieslarawgvfdevktitlkamngtdfhkslilrvsklknm
plklakevceslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsntl
ivendalnglvtghmmfshskgemllvlqrllnisktntlvvgdgandlsmfkhahikia
fnakevlkqhathcinepdlalikplie

SCOPe Domain Coordinates for d3m1yc_:

Click to download the PDB-style file with coordinates for d3m1yc_.
(The format of our PDB-style files is described here.)

Timeline for d3m1yc_: