Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (20 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [189290] (1 PDB entry) |
Domain d3m1yb_: 3m1y B: [180726] automated match to d1f5sa_ complexed with cl, mg |
PDB Entry: 3m1y (more details), 2.4 Å
SCOPe Domain Sequences for d3m1yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m1yb_ c.108.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 210]} qklavfdfdstlvnaetieslarawgvfdevktitlkamngetdfhkslilrvsklknmp lklakevceslplfegalelvsalkeknykvvcfsggfdlatnhyrdllhldaafsntli vendalnglvtghmmfshskgemllvlqrllnisktntlvvgdgandlsmfkhahikiaf nakevlkqhathcinepdlalikpli
Timeline for d3m1yb_: