Lineage for d3m1vf_ (3m1v F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955026Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2955027Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins)
    automatically mapped to Pfam PF02240
  6. 2955028Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 2955029Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (15 PDB entries)
  8. 2955047Domain d3m1vf_: 3m1v F: [180723]
    Other proteins in same PDB: d3m1va1, d3m1va2, d3m1vb1, d3m1vb2, d3m1vd1, d3m1vd2, d3m1ve1, d3m1ve2
    automated match to d1hbmc_
    complexed with act, com, edo, f43, mg, peg, tp7, zn

Details for d3m1vf_

PDB Entry: 3m1v (more details), 1.45 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues
PDB Compounds: (F:) Methyl-coenzyme M reductase I subunit gamma

SCOPe Domain Sequences for d3m1vf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m1vf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfn

SCOPe Domain Coordinates for d3m1vf_:

Click to download the PDB-style file with coordinates for d3m1vf_.
(The format of our PDB-style files is described here.)

Timeline for d3m1vf_: