Lineage for d3m1ta1 (3m1t A:1-274)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (9 species)
    not a true protein
  7. 2015450Species Shewanella amazonensis [TaxId:326297] [189692] (1 PDB entry)
  8. 2015451Domain d3m1ta1: 3m1t A:1-274 [180721]
    Other proteins in same PDB: d3m1ta2
    automated match to d1vqrc_
    complexed with gol

Details for d3m1ta1

PDB Entry: 3m1t (more details), 1.62 Å

PDB Description: crystal structure of putative phosphohydrolase (yp_929327.1) from shewanella amazonensis sb2b at 1.62 a resolution
PDB Compounds: (A:) Putative phosphohydrolase

SCOPe Domain Sequences for d3m1ta1:

Sequence, based on SEQRES records: (download)

>d3m1ta1 a.211.1.0 (A:1-274) automated matches {Shewanella amazonensis [TaxId: 326297]}
mhsaallqkvdelprlpkaiaelldvvnnedstvkavseklshdpvlsarvlrlansarf
gcsrevgtiddavvrlgmqtlrtlviasavvgavpkvegfdladfwgntfevaiicqela
krlgtlpeeaftcgilhsigellivngdpavaatisaavadgadrnlmekellgydnaei
gallaqswkftphlvkgiqfqnhpksaepysklagmlamakqiaadwdkipddertswla
qinilagikvdlgglaeklakmhgqgmemgkqla

Sequence, based on observed residues (ATOM records): (download)

>d3m1ta1 a.211.1.0 (A:1-274) automated matches {Shewanella amazonensis [TaxId: 326297]}
mhsaallqkvdelprlpkaiaelldvvnnedstvkavseklshdpvlsarvlrlansaev
gtiddavvrlgmqtlrtlviasavvgavpkvegfdladfwgntfevaiicqelakrlgtl
peeaftcgilhsigellivngdpavaatisaavadgadrnlmekellgydnaeigallaq
swkftphlvkgiqfqnhpksaepysklagmlamakqiaadwdkipddertswlaqinila
gikvdlgglaeklakmhgqgmemgkqla

SCOPe Domain Coordinates for d3m1ta1:

Click to download the PDB-style file with coordinates for d3m1ta1.
(The format of our PDB-style files is described here.)

Timeline for d3m1ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3m1ta2