Lineage for d3m1ob_ (3m1o B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2035040Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2035041Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 protein domains)
    automatically mapped to Pfam PF00576
  6. 2035042Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2035063Species Human (Homo sapiens) [TaxId:9606] [49475] (276 PDB entries)
    Uniprot P02766 31-143
  8. 2035067Domain d3m1ob_: 3m1o B: [180719]
    automated match to d1eta1_
    complexed with cjz

Details for d3m1ob_

PDB Entry: 3m1o (more details), 1.2 Å

PDB Description: human transthyretin (ttr) complexed with 2-((3,5-dichloro-4- hydroxyphenyl)amino)benzoic acid
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d3m1ob_:

Sequence, based on SEQRES records: (download)

>d3m1ob_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt

Sequence, based on observed residues (ATOM records): (download)

>d3m1ob_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandrrytiaallspysysttavvt

SCOPe Domain Coordinates for d3m1ob_:

Click to download the PDB-style file with coordinates for d3m1ob_.
(The format of our PDB-style files is described here.)

Timeline for d3m1ob_: