Lineage for d3m15c_ (3m15 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699501Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 2699502Protein Cytochrome b562 [47177] (1 species)
  7. 2699503Species Escherichia coli [TaxId:562] [47178] (75 PDB entries)
  8. 2699726Domain d3m15c_: 3m15 C: [180708]
    automated match to d1qq3a_
    complexed with hem, zn

Details for d3m15c_

PDB Entry: 3m15 (more details), 2.6 Å

PDB Description: a zn-mediated asymmetric trimer of a cytochrome cb562 variant (d74a- ridc1)
PDB Compounds: (C:) Soluble cytochrome b562

SCOPe Domain Sequences for d3m15c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m15c_ a.24.3.1 (C:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihaalhlanegkvkeaqaaaeqlkttcnachqkyr

SCOPe Domain Coordinates for d3m15c_:

Click to download the PDB-style file with coordinates for d3m15c_.
(The format of our PDB-style files is described here.)

Timeline for d3m15c_: