![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188447] (254 PDB entries) |
![]() | Domain d3m11a_: 3m11 A: [180704] automated match to d1ol5a_ complexed with aki |
PDB Entry: 3m11 (more details), 2.75 Å
SCOPe Domain Sequences for d3m11a_:
Sequence, based on SEQRES records: (download)
>d3m11a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrtdlcgtldylppemiegrm hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk hnpsqrpmlrevlehpwitansskps
>d3m11a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals ychskrvihrdikpenlllgsagelkiadfgwsvhgtldylppemiegrmhdekvdlwsl gvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlr evlehpwitansskps
Timeline for d3m11a_: