Lineage for d2bpfa1 (2bpf A:9-91)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916790Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 917086Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 917087Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 917088Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 917197Species Norway rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries)
  8. 917202Domain d2bpfa1: 2bpf A:9-91 [18070]
    Other proteins in same PDB: d2bpfa3, d2bpfa4
    protein/DNA complex; complexed with dct, mg

Details for d2bpfa1

PDB Entry: 2bpf (more details), 2.9 Å

PDB Description: structures of ternary complexes of rat dna polymerase beta, a dna template-primer, and ddctp
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d2bpfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpfa1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
etlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOPe Domain Coordinates for d2bpfa1:

Click to download the PDB-style file with coordinates for d2bpfa1.
(The format of our PDB-style files is described here.)

Timeline for d2bpfa1: