SCOPe 2.08: Domain d2bpfa1: 2bpf A:9-91

Lineage for d2bpfa1 (2bpf A:9-91)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47806] (15 PDB entries)

8. Domain d2bpfa1: 2bpf A:9-91 [18070]
   Other proteins in same PDB: d2bpfa3, d2bpfa4
   protein/DNA complex; complexed with dct, mg

Details for d2bpfa1

PDB Entry: 2bpf, 2.9 Å

PDB Description: structures of ternary complexes of rat dna polymerase beta, a dna template-primer, and ddctp

PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d2bpfa1:

Sequence; same for both SEQRES and ATOM records:

>d2bpfa1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
etlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

Timeline for d2bpfa1:

• d2bpfa1 first appeared (with stable ids) in SCOP 1.55
  
• d2bpfa1 appears in SCOPe 2.07