Lineage for d3m0wg_ (3m0w G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710101Protein Calcyclin (S100) [47479] (17 species)
  7. 2710220Species Human (Homo sapiens), s100a4 [TaxId:9606] [81754] (9 PDB entries)
    MTS1 protein
  8. 2710259Domain d3m0wg_: 3m0w G: [180696]
    automated match to d1m31a_
    complexed with ca, dio, p77

Details for d3m0wg_

PDB Entry: 3m0w (more details), 2.8 Å

PDB Description: structure of s100a4 with pcp
PDB Compounds: (G:) Protein S100-A4

SCOPe Domain Sequences for d3m0wg_:

Sequence, based on SEQRES records: (download)

>d3m0wg_ a.39.1.2 (G:) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}
acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
ldsnrdnevdfqeycvflsciammcneffe

Sequence, based on observed residues (ATOM records): (download)

>d3m0wg_ a.39.1.2 (G:) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}
acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgeaafqklmsnldsn
rdnevdfqeycvflsciammcneffe

SCOPe Domain Coordinates for d3m0wg_:

Click to download the PDB-style file with coordinates for d3m0wg_.
(The format of our PDB-style files is described here.)

Timeline for d3m0wg_: