Lineage for d3m0sa_ (3m0s A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053739Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 2053740Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries)
  8. 2053744Domain d3m0sa_: 3m0s A: [180687]
    automated match to d1aeya_
    complexed with so4; mutant

Details for d3m0sa_

PDB Entry: 3m0s (more details), 1.6 Å

PDB Description: crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 7
PDB Compounds: (A:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d3m0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m0sa_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
kelvlalydyqekspdevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld

SCOPe Domain Coordinates for d3m0sa_:

Click to download the PDB-style file with coordinates for d3m0sa_.
(The format of our PDB-style files is described here.)

Timeline for d3m0sa_: