Lineage for d3m0pa_ (3m0p A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392511Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 2392512Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries)
  8. 2392537Domain d3m0pa_: 3m0p A: [180684]
    automated match to d1pwta_
    complexed with so4; mutant

Details for d3m0pa_

PDB Entry: 3m0p (more details), 2.6 Å

PDB Description: crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 4.
PDB Compounds: (A:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d3m0pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m0pa_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
elvlalydyqekspdevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld

SCOPe Domain Coordinates for d3m0pa_:

Click to download the PDB-style file with coordinates for d3m0pa_.
(The format of our PDB-style files is described here.)

Timeline for d3m0pa_: