Lineage for d3m09a1 (3m09 A:1-157)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903517Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)
  7. 2903719Species Staphylococcus aureus [TaxId:1280] [188976] (33 PDB entries)
  8. 2903725Domain d3m09a1: 3m09 A:1-157 [180680]
    Other proteins in same PDB: d3m09a2
    automated match to d1dhja_
    complexed with gol, nap, rar

Details for d3m09a1

PDB Entry: 3m09 (more details), 2.01 Å

PDB Description: f98y tmp-resistant dihydrofolate reductase from staphylococcus aureus with inhibitor rab1
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3m09a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m09a1 c.71.1.1 (A:1-157) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d3m09a1:

Click to download the PDB-style file with coordinates for d3m09a1.
(The format of our PDB-style files is described here.)

Timeline for d3m09a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3m09a2