Lineage for d3m08a_ (3m08 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1871771Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1871800Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)
  7. 1871932Species Staphylococcus aureus [TaxId:1280] [188976] (21 PDB entries)
  8. 1871939Domain d3m08a_: 3m08 A: [180679]
    automated match to d1ddra_
    complexed with gol, nap, rar

Details for d3m08a_

PDB Entry: 3m08 (more details), 2.01 Å

PDB Description: Wild Type Dihydrofolate Reductase from Staphylococcus aureus with inhibitor RAB1
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3m08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m08a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirkavpr

SCOPe Domain Coordinates for d3m08a_:

Click to download the PDB-style file with coordinates for d3m08a_.
(The format of our PDB-style files is described here.)

Timeline for d3m08a_: