| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
| Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species) |
| Species Staphylococcus aureus [TaxId:1280] [188976] (21 PDB entries) |
| Domain d3m08a_: 3m08 A: [180679] automated match to d1ddra_ complexed with gol, nap, rar |
PDB Entry: 3m08 (more details), 2.01 Å
SCOPe Domain Sequences for d3m08a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m08a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirkavpr
Timeline for d3m08a_: