SCOPe 2.08: Domain d3m08a1: 3m08 A:1-157

Lineage for d3m08a1 (3m08 A:1-157)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)

7. Species Staphylococcus aureus [TaxId:1280] [188976] (33 PDB entries)

8. Domain d3m08a1: 3m08 A:1-157 [180679]
   Other proteins in same PDB: d3m08a2
   automated match to d1ddra_
   complexed with gol, nap, rar

Details for d3m08a1

PDB Entry: 3m08, 2.01 Å

PDB Description: Wild Type Dihydrofolate Reductase from Staphylococcus aureus with inhibitor RAB1

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3m08a1:

Sequence; same for both SEQRES and ATOM records:

>d3m08a1 c.71.1.1 (A:1-157) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

Timeline for d3m08a1:

• d3m08a1 first appeared in SCOPe 2.01, called d3m08a_
  
• d3m08a1 appears in SCOPe 2.07