SCOPe 2.03: Domain d3lzvb_: 3lzv B:

Lineage for d3lzvb_ (3lzv B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (20 PDB entries)

8. Domain d3lzvb_: 3lzv B: [180674]
   automated match to d1kzka_
   complexed with 017, act, po4

Details for d3lzvb_

PDB Entry: 3lzv, 2.15 Å

PDB Description: structure of nelfinavir-resistant hiv-1 protease (d30n/n88d) in complex with darunavir.

PDB Compounds: (B:) hiv-1 protease

SCOPe Domain Sequences for d3lzvb_:

Sequence; same for both SEQRES and ATOM records:

>d3lzvb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrplvtiriggqlkealldtgadntvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrdlltqigctlnf

Timeline for d3lzvb_:

• d3lzvb_ first appeared in SCOPe 2.01
  
• d3lzvb_ appears in SCOPe 2.02
  
• d3lzvb_ appears in SCOPe 2.04
  
• d3lzvb_ appears in the current release, SCOPe 2.08