Lineage for d3lzua_ (3lzu A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2408657Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2408673Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2408922Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (578 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 2409619Domain d3lzua_: 3lzu A: [180671]
    automated match to d1a8ga_
    complexed with 017, act

Details for d3lzua_

PDB Entry: 3lzu (more details), 1.76 Å

PDB Description: crystal structure of a nelfinavir resistant hiv-1 crf01_ae protease variant (n88s) in complex with the protease inhibitor darunavir.
PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d3lzua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lzua_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtvkiggqlkealldtgaddtvledinlpgkwkpkmiggiggfikvrqyd
qilieicgkkaigtvlvgptpvniigrsmltqigctlnf

SCOPe Domain Coordinates for d3lzua_:

Click to download the PDB-style file with coordinates for d3lzua_.
(The format of our PDB-style files is described here.)

Timeline for d3lzua_: