Lineage for d9icea1 (9ice A:9-91)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48649Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 48731Superfamily a.60.6: DNA polymerase beta, N-terminal (8 kD)-domain [47802] (1 family) (S)
  5. 48732Family a.60.6.1: DNA polymerase beta, N-terminal (8 kD)-domain [47803] (1 protein)
  6. 48733Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
  7. 48734Species Human (Homo sapiens) [TaxId:9606] [47805] (90 PDB entries)
  8. 48822Domain d9icea1: 9ice A:9-91 [18067]
    Other proteins in same PDB: d9icea2

Details for d9icea1

PDB Entry: 9ice (more details), 3.3 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of datp (1 millimolar) and cucl2 (0.1 millimolar)

SCOP Domain Sequences for d9icea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icea1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOP Domain Coordinates for d9icea1:

Click to download the PDB-style file with coordinates for d9icea1.
(The format of our PDB-style files is described here.)

Timeline for d9icea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d9icea2