Lineage for d3lzgk1 (3lzg K:11-325)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040435Domain d3lzgk1: 3lzg K:11-325 [180668]
    Other proteins in same PDB: d3lzgb1, d3lzgb2, d3lzgd_, d3lzgf_, d3lzgh_, d3lzgj_, d3lzgk2, d3lzgl_
    automated match to d1ruyh_
    complexed with nag

Details for d3lzgk1

PDB Entry: 3lzg (more details), 2.6 Å

PDB Description: Crystal structure of a 2009 H1N1 influenza virus hemagglutinin
PDB Compounds: (K:) Hemagglutinin, HA1 SUBUNIT

SCOPe Domain Sequences for d3lzgk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lzgk1 b.19.1.2 (K:11-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnips

SCOPe Domain Coordinates for d3lzgk1:

Click to download the PDB-style file with coordinates for d3lzgk1.
(The format of our PDB-style files is described here.)

Timeline for d3lzgk1: