SCOPe 2.06: Domain d3lz7c1: 3lz7 C:1-138

Lineage for d3lz7c1 (3lz7 C:1-138)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein Hypothetical protein HI1161 [89905] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [89906] (3 PDB entries)

8. Domain d3lz7c1: 3lz7 C:1-138 [180659]
   Other proteins in same PDB: d3lz7a2, d3lz7b2, d3lz7c2, d3lz7d2
   automated match to d1o0ia_
   complexed with peg

Details for d3lz7c1

PDB Entry: 3lz7, 2.19 Å

PDB Description: crystal structure of thioesterase hi1161 ec3.1.2.- from haemophilus influenzae. orthorombic crystal form. northeast structural genomics consortium target ir63

PDB Compounds: (C:) Putative esterase HI1161

SCOPe Domain Sequences for d3lz7c1:

Sequence; same for both SEQRES and ATOM records:

>d3lz7c1 d.38.1.5 (C:1-138) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]}
mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
eenklccvsrltlsvinl

Timeline for d3lz7c1:

• d3lz7c1 first appeared in SCOPe 2.01, called d3lz7c_
  
• d3lz7c1 was called d3lz7c_ in SCOPe 2.05
  
• d3lz7c1 appears in SCOPe 2.07
  
• d3lz7c1 appears in the current release, SCOPe 2.08