Lineage for d3lz7c_ (3lz7 C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023831Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1023832Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1024054Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 1024066Protein Hypothetical protein HI1161 [89905] (1 species)
  7. 1024067Species Haemophilus influenzae [TaxId:727] [89906] (2 PDB entries)
  8. 1024070Domain d3lz7c_: 3lz7 C: [180659]
    automated match to d1o0ia_
    complexed with peg

Details for d3lz7c_

PDB Entry: 3lz7 (more details), 2.19 Å

PDB Description: crystal structure of thioesterase hi1161 ec3.1.2.- from haemophilus influenzae. orthorombic crystal form. northeast structural genomics consortium target ir63
PDB Compounds: (C:) Putative esterase HI1161

SCOPe Domain Sequences for d3lz7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lz7c_ d.38.1.5 (C:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]}
mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
eenklccvsrltlsvinllehhh

SCOPe Domain Coordinates for d3lz7c_:

Click to download the PDB-style file with coordinates for d3lz7c_.
(The format of our PDB-style files is described here.)

Timeline for d3lz7c_: