Lineage for d3lz7c1 (3lz7 C:1-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943866Protein Hypothetical protein HI1161 [89905] (1 species)
  7. 2943867Species Haemophilus influenzae [TaxId:727] [89906] (3 PDB entries)
  8. 2943872Domain d3lz7c1: 3lz7 C:1-138 [180659]
    Other proteins in same PDB: d3lz7a2, d3lz7b2, d3lz7c2, d3lz7d2
    automated match to d1o0ia_
    complexed with peg

Details for d3lz7c1

PDB Entry: 3lz7 (more details), 2.19 Å

PDB Description: crystal structure of thioesterase hi1161 ec3.1.2.- from haemophilus influenzae. orthorombic crystal form. northeast structural genomics consortium target ir63
PDB Compounds: (C:) Putative esterase HI1161

SCOPe Domain Sequences for d3lz7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lz7c1 d.38.1.5 (C:1-138) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]}
mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
eenklccvsrltlsvinl

SCOPe Domain Coordinates for d3lz7c1:

Click to download the PDB-style file with coordinates for d3lz7c1.
(The format of our PDB-style files is described here.)

Timeline for d3lz7c1: