SCOPe 2.02: Domain d3lz7b_: 3lz7 B:

Lineage for d3lz7b_ (3lz7 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein Hypothetical protein HI1161 [89905] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [89906] (2 PDB entries)

8. Domain d3lz7b_: 3lz7 B: [180658]
   automated match to d1o0ia_
   complexed with peg

Details for d3lz7b_

PDB Entry: 3lz7, 2.19 Å

PDB Description: crystal structure of thioesterase hi1161 ec3.1.2.- from haemophilus influenzae. orthorombic crystal form. northeast structural genomics consortium target ir63

PDB Compounds: (B:) Putative esterase HI1161

SCOPe Domain Sequences for d3lz7b_:

Sequence; same for both SEQRES and ATOM records:

>d3lz7b_ d.38.1.5 (B:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]}
mlwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsva
laetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirt
eenklccvsrltlsvinlle

Timeline for d3lz7b_:

• d3lz7b_ first appeared in SCOPe 2.01
  
• d3lz7b_ appears in SCOPe 2.03
  
• d3lz7b_ appears in the current release, SCOPe 2.08, called d3lz7b1