SCOPe 2.06: Domain d3lz1g_: 3lz1 G:

Lineage for d3lz1g_ (3lz1 G:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (6 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (34 PDB entries)

8. Domain d3lz1g_: 3lz1 G: [180650]
   Other proteins in same PDB: d3lz1a_, d3lz1e_
   automated match to d1kx5c_
   protein/DNA complex; complexed with cl, mn

Details for d3lz1g_

PDB Entry: 3lz1, 2.5 Å

PDB Description: Crystal Structure of Nucleosome Core Particle Composed of the Widom 601 DNA Sequence (orientation 2)

PDB Compounds: (G:) histone h2a

SCOPe Domain Sequences for d3lz1g_:

Sequence; same for both SEQRES and ATOM records:

>d3lz1g_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

Timeline for d3lz1g_:

• d3lz1g_ first appeared in SCOPe 2.01
  
• d3lz1g_ appears in SCOPe 2.05
  
• d3lz1g_ appears in SCOPe 2.07
  
• d3lz1g_ appears in the current release, SCOPe 2.08