Lineage for d3lz1c_ (3lz1 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2311422Protein Histone H2A [47115] (6 species)
  7. 2311423Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (37 PDB entries)
  8. 2311468Domain d3lz1c_: 3lz1 C: [180648]
    Other proteins in same PDB: d3lz1a_, d3lz1e_
    automated match to d1kx5c_
    protein/DNA complex; complexed with cl, mn

Details for d3lz1c_

PDB Entry: 3lz1 (more details), 2.5 Å

PDB Description: Crystal Structure of Nucleosome Core Particle Composed of the Widom 601 DNA Sequence (orientation 2)
PDB Compounds: (C:) histone h2a

SCOPe Domain Sequences for d3lz1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lz1c_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
trssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnkk
triiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

SCOPe Domain Coordinates for d3lz1c_:

Click to download the PDB-style file with coordinates for d3lz1c_.
(The format of our PDB-style files is described here.)

Timeline for d3lz1c_: