Lineage for d3lyla_ (3lyl A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1346668Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1347798Protein automated matches [190085] (38 species)
    not a true protein
  7. 1347898Species Francisella tularensis [TaxId:177416] [189289] (1 PDB entry)
  8. 1347899Domain d3lyla_: 3lyl A: [180639]
    automated match to d1q7ba_

Details for d3lyla_

PDB Entry: 3lyl (more details), 1.95 Å

PDB Description: Structure of 3-oxoacyl-acylcarrier protein reductase, FabG from Francisella tularensis
PDB Compounds: (A:) 3-oxoacyl-(acyl-carrier-protein) reductase

SCOPe Domain Sequences for d3lyla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lyla_ c.2.1.2 (A:) automated matches {Francisella tularensis [TaxId: 177416]}
mslnekvalvtgasrgigfevahalaskgatvvgtatsqasaekfensmkekgfkarglv
lnisdiesiqnffaeikaenlaidilvnnagitrdnlmmrmsedewqsvintnlssifrm
skecvrgmmkkrwgriisigsvvgsagnpgqtnycaakagvigfskslayevasrnitvn
vvapgfiatdmtdkltdeqksfiatkipsgqigepkdiaaavaflaseeakyitgqtlhv
nggmyma

SCOPe Domain Coordinates for d3lyla_:

Click to download the PDB-style file with coordinates for d3lyla_.
(The format of our PDB-style files is described here.)

Timeline for d3lyla_: