SCOPe 2.05: Domain d3ly4a_: 3ly4 A:

Lineage for d3ly4a_ (3ly4 A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Bacillus licheniformis [TaxId:1402] [56612] (11 PDB entries)

8. Domain d3ly4a_: 3ly4 A: [180638]
   automated match to d1mbla_
   complexed with pnm

Details for d3ly4a_

PDB Entry: 3ly4, 1.8 Å

PDB Description: crystal structure of fluorophore-labeled class a -lactamase penp- e166cb in complex with penicillin g

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3ly4a_:

Sequence; same for both SEQRES and ATOM records:

>d3ly4a_ e.3.1.1 (A:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]}
kddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedln
qritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkel
rkigdevtnperfcpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmk
rnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdaky
ddkliaeatkvvmkaln

Timeline for d3ly4a_:

• d3ly4a_ first appeared in SCOPe 2.01
  
• d3ly4a_ appears in SCOPe 2.04
  
• d3ly4a_ appears in SCOPe 2.06
  
• d3ly4a_ appears in the current release, SCOPe 2.08