Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Novosphingobium aromaticivorans [TaxId:279238] [189372] (11 PDB entries) |
Domain d3lxhb_: 3lxh B: [180623] automated match to d1j51a_ complexed with dio, hem, po4 |
PDB Entry: 3lxh (more details), 2.2 Å
SCOPe Domain Sequences for d3lxhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lxhb_ a.104.1.0 (B:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]} hrvappphvpghlireidaydldgleqgfheawkrvqqpdtpplvwtpftgghwiatrgt lideiyrsperfssrviwvpreageaydmvptkldppehtpyrkaidkglnlaeirkled qirtiaveiiegfadrghcefgsefstvfpvrvflalaglpvedatklgllanemtrpsg ntpeeqgrsleaankgffeyvapiiaarrggsgtdlitrilnveidgkpmpddralglvs llllggldtvvnflgfmmiylsrhpetvaemrreplklqrgveelfrrfavvsdaryvvs dmefhgtmlkegdlillptalhglddrhhddpmtvdlsrrdvthstfaqgphrcagmhla rlevtvmlqewlaripefrlkdravpiyhsgivaaveniplewep
Timeline for d3lxhb_: