SCOPe 2.06: Domain d3lxfe_: 3lxf E:

Lineage for d3lxfe_ (3lxf E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (21 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:279238] [189373] (1 PDB entry)

8. Domain d3lxfe_: 3lxf E: [180621]
   automated match to d1e9ma_
   complexed with fes

Details for d3lxfe_

PDB Entry: 3lxf, 2.3 Å

PDB Description: Crystal Structure of [2Fe-2S] Ferredoxin Arx from Novosphingobium aromaticivorans

PDB Compounds: (E:) ferredoxin

SCOPe Domain Sequences for d3lxfe_:

Sequence; same for both SEQRES and ATOM records:

>d3lxfe_ d.15.4.0 (E:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
palsgdendlldssdhrtphsrlscqitindklegleveiaped

Timeline for d3lxfe_:

• d3lxfe_ first appeared in SCOPe 2.01
  
• d3lxfe_ appears in SCOPe 2.05
  
• d3lxfe_ appears in SCOPe 2.07
  
• d3lxfe_ appears in the current release, SCOPe 2.08