Lineage for d3lxfd_ (3lxf D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018449Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1018704Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 1018705Protein automated matches [191164] (4 species)
    not a true protein
  7. 1018712Species Novosphingobium aromaticivorans [TaxId:279238] [189373] (1 PDB entry)
  8. 1018716Domain d3lxfd_: 3lxf D: [180620]
    automated match to d1e9ma_
    complexed with fes

Details for d3lxfd_

PDB Entry: 3lxf (more details), 2.3 Å

PDB Description: Crystal Structure of [2Fe-2S] Ferredoxin Arx from Novosphingobium aromaticivorans
PDB Compounds: (D:) ferredoxin

SCOPe Domain Sequences for d3lxfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lxfd_ d.15.4.0 (D:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
palsgdendlldssdhrtphsrlscqitindklegleveiaped

SCOPe Domain Coordinates for d3lxfd_:

Click to download the PDB-style file with coordinates for d3lxfd_.
(The format of our PDB-style files is described here.)

Timeline for d3lxfd_: