Lineage for d3lxfc_ (3lxf C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2934202Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2934203Protein automated matches [191164] (24 species)
    not a true protein
  7. 2934269Species Novosphingobium aromaticivorans [TaxId:279238] [189373] (1 PDB entry)
  8. 2934272Domain d3lxfc_: 3lxf C: [180619]
    automated match to d1e9ma_
    complexed with fes

Details for d3lxfc_

PDB Entry: 3lxf (more details), 2.3 Å

PDB Description: Crystal Structure of [2Fe-2S] Ferredoxin Arx from Novosphingobium aromaticivorans
PDB Compounds: (C:) ferredoxin

SCOPe Domain Sequences for d3lxfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lxfc_ d.15.4.0 (C:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl
palsgdendlldssdhrtphsrlscqitindklegleveiaped

SCOPe Domain Coordinates for d3lxfc_:

Click to download the PDB-style file with coordinates for d3lxfc_.
(The format of our PDB-style files is described here.)

Timeline for d3lxfc_: