![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Novosphingobium aromaticivorans [TaxId:279238] [189373] (1 PDB entry) |
![]() | Domain d3lxfa_: 3lxf A: [180617] automated match to d1e9ma_ complexed with fes |
PDB Entry: 3lxf (more details), 2.3 Å
SCOPe Domain Sequences for d3lxfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lxfa_ d.15.4.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]} tailvttrdgtrteiqaepglslmealrdagidellalcggccscatchvlvapafadrl palsgdendlldssdhrtphsrlscqitindklegleveiaped
Timeline for d3lxfa_:
![]() Domains from other chains: (mouse over for more information) d3lxfb_, d3lxfc_, d3lxfd_, d3lxfe_ |