SCOPe 2.01: Domain d3lxeb_: 3lxe B:

Lineage for d3lxeb_ (3lxe B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (16 PDB entries)

8. Domain d3lxeb_: 3lxe B: [180616]
   automated match to d1bzma_
   complexed with tor, zn

Details for d3lxeb_

PDB Entry: 3lxe, 1.9 Å

PDB Description: Human Carbonic Anhydrase I in complex with topiramate

PDB Compounds: (B:) Carbonic anhydrase 1

SCOPe Domain Sequences for d3lxeb_:

Sequence; same for both SEQRES and ATOM records:

>d3lxeb_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

Timeline for d3lxeb_:

• d3lxeb_ is new in SCOPe 2.01-stable
  
• d3lxeb_ appears in SCOPe 2.02
  
• d3lxeb_ appears in the current release, SCOPe 2.08