SCOPe 2.07: Domain d3lwvb_: 3lwv B:

Lineage for d3lwvb_ (3lwv B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family)
   automatically mapped to Pfam PF04135

5. Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
   Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)

6. Protein automated matches [190486] (2 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [187680] (2 PDB entries)

8. Domain d3lwvb_: 3lwv B: [180612]
   automated match to d2hvyc1
   protein/RNA complex; complexed with zn

Details for d3lwvb_

PDB Entry: 3lwv, 2.5 Å

PDB Description: Structure of H/ACA RNP bound to a substrate RNA containing 2'-deoxyuridine

PDB Compounds: (B:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d3lwvb_:

Sequence; same for both SEQRES and ATOM records:

>d3lwvb_ g.41.16.1 (B:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi

Timeline for d3lwvb_:

• d3lwvb_ first appeared in SCOPe 2.01
  
• d3lwvb_ appears in SCOPe 2.06
  
• d3lwvb_ appears in the current release, SCOPe 2.08