![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) ![]() automatically mapped to Pfam PF04135 |
![]() | Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins) Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204) |
![]() | Protein automated matches [190486] (2 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:2261] [187680] (2 PDB entries) |
![]() | Domain d3lwvb_: 3lwv B: [180612] automated match to d2hvyc1 protein/RNA complex; complexed with zn |
PDB Entry: 3lwv (more details), 2.5 Å
SCOPe Domain Sequences for d3lwvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lwvb_ g.41.16.1 (B:) automated matches {Pyrococcus furiosus [TaxId: 2261]} frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
Timeline for d3lwvb_: