| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein RhoA [52612] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries) Uniprot P61586 2-181 |
| Domain d3lwna1: 3lwn A:2-181 [180606] Other proteins in same PDB: d3lwna2, d3lwnb2 automated match to d1x86b_ complexed with gdp, mg |
PDB Entry: 3lwn (more details), 2.28 Å
SCOPe Domain Sequences for d3lwna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lwna1 c.37.1.8 (A:2-181) RhoA {Human (Homo sapiens) [TaxId: 9606]}
aairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdta
gqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdl
rndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa
Timeline for d3lwna1: