Lineage for d3lwna1 (3lwn A:2-181)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867786Protein RhoA [52612] (1 species)
  7. 2867787Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries)
    Uniprot P61586 2-181
  8. 2867809Domain d3lwna1: 3lwn A:2-181 [180606]
    Other proteins in same PDB: d3lwna2, d3lwnb2
    automated match to d1x86b_
    complexed with gdp, mg

Details for d3lwna1

PDB Entry: 3lwn (more details), 2.28 Å

PDB Description: Shigella IpgB2 in complex with human RhoA, GDP and Mg2+ (complex B)
PDB Compounds: (A:) transforming protein rhoa

SCOPe Domain Sequences for d3lwna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lwna1 c.37.1.8 (A:2-181) RhoA {Human (Homo sapiens) [TaxId: 9606]}
aairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdta
gqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdl
rndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

SCOPe Domain Coordinates for d3lwna1:

Click to download the PDB-style file with coordinates for d3lwna1.
(The format of our PDB-style files is described here.)

Timeline for d3lwna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lwna2