SCOPe 2.08: Domain d3lweb_: 3lwe B:

Lineage for d3lweb_ (3lwe B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.0: automated matches [191621] (1 protein)
   not a true family

6. Protein automated matches [191139] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189257] (7 PDB entries)

8. Domain d3lweb_: 3lwe B: [180605]
   automated match to d2dnta1

Details for d3lweb_

PDB Entry: 3lwe, 2.05 Å

PDB Description: the crystal structure of mpp8

PDB Compounds: (B:) M-phase phosphoprotein 8

SCOPe Domain Sequences for d3lweb_:

Sequence; same for both SEQRES and ATOM records:

>d3lweb_ b.34.13.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaen

Timeline for d3lweb_:

• d3lweb_ first appeared in SCOPe 2.01
  
• d3lweb_ appears in SCOPe 2.07