Lineage for d3lw2a_ (3lw2 A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568351Protein automated matches [190484] (2 species)
    not a true protein
  7. 2568378Species Mouse (Mus musculus) [TaxId:10090] [189297] (1 PDB entry)
  8. 2568379Domain d3lw2a_: 3lw2 A: [180599]
    automated match to d1a7ca_

Details for d3lw2a_

PDB Entry: 3lw2 (more details), 1.93 Å

PDB Description: mouse plasminogen activator inhibitor-1 (pai-1)
PDB Compounds: (A:) Plasminogen activator inhibitor 1

SCOPe Domain Sequences for d3lw2a_:

Sequence, based on SEQRES records: (download)

>d3lw2a_ e.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
htahqatdfgvkvfqqvvqaskdrnvvfspygvssvlamlqmttagktrrqiqdamgfkv
nekgtahalrqlskelmgpwnkneistadaifvqrdlelvqgfmphffklfqtmvkqvdf
severarfiindwverhtkgmindllakgavdeltrlvlvnalyfsgqwktpfleasthq
rlfhksdgstvsvpmmaqsnkfnytefttpdgleydvvelpyqgdtlsmfiaapfekdvh
lsaltnildaelirqwkgnmtrlprllilpkfsletevdlrgpleklgmpdmfsatladf
tslsdqeqlsvaqalqkvrievnesgtvassstafvisarmaptemvidrsflfvvrhnp
tetilfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d3lw2a_ e.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
htahqatdfgvkvfqqvvqaskdrnvvfspygvssvlamlqmttagktrrqiqdamgfkv
nekgtahalrqlskelmgpwnkneistadaifvqrdlelvqgfmphffklfqtmvkqvdf
severarfiindwverhtkgmindllakgavdeltrlvlvnalyfsgqwktpfleasthq
rlvsvpmmaqsnkfnytefttpdgleydvvelpyqgdtlsmfiaapfekdvhlsaltnil
daelirqwkgnmtrlprllilpkfsletevdlrgpleklgmpdmfsatladftslsdqeq
lsvaqalqkvrievnesgtvassstafvisarmaptemvidrsflfvvrhnptetilfmg
qvmep

SCOPe Domain Coordinates for d3lw2a_:

Click to download the PDB-style file with coordinates for d3lw2a_.
(The format of our PDB-style files is described here.)

Timeline for d3lw2a_: