Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.3: SirA-like [64307] (1 family) |
Family d.68.3.3: SirA-like [88852] (5 proteins) predicted redox protein, regulator of disulfide bond formation |
Protein automated matches [191153] (1 species) not a true protein |
Species Escherichia coli [TaxId:155864] [189315] (2 PDB entries) |
Domain d3lvkb_: 3lvk B: [180593] Other proteins in same PDB: d3lvka_ automated match to d1dcja_ protein/RNA complex; complexed with plp |
PDB Entry: 3lvk (more details), 2.44 Å
SCOPe Domain Sequences for d3lvkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lvkb_ d.68.3.3 (B:) automated matches {Escherichia coli [TaxId: 155864]} lfsspdhtldalglrcpepvmmvrktvrnmqpgetlliiaddpattrdipgfctfmehel vaketdglpyrylirk
Timeline for d3lvkb_: