SCOPe 2.02: Domain d3lvjc_: 3lvj C:

Lineage for d3lvjc_ (3lvj C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.3: SirA-like [64307] (1 family)

5. Family d.68.3.3: SirA-like [88852] (5 proteins)
   predicted redox protein, regulator of disulfide bond formation

6. Protein automated matches [191153] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:155864] [189315] (2 PDB entries)

8. Domain d3lvjc_: 3lvj C: [180591]
   automated match to d1dcja_
   protein/RNA complex; complexed with plp

Details for d3lvjc_

PDB Entry: 3lvj, 2.44 Å

PDB Description: crystal structure of e.coli iscs-tusa complex (form 1)

PDB Compounds: (C:) Sulfurtransferase tusA

SCOPe Domain Sequences for d3lvjc_:

Sequence; same for both SEQRES and ATOM records:

>d3lvjc_ d.68.3.3 (C:) automated matches {Escherichia coli [TaxId: 155864]}
lfsspdhtldalglrcpepvmmvrktvrnmqpgetlliiaddpattrdipgfctfmehel
vaketdglpyrylirkg

Timeline for d3lvjc_:

• d3lvjc_ first appeared in SCOPe 2.01
  
• d3lvjc_ appears in SCOPe 2.03
  
• d3lvjc_ appears in the current release, SCOPe 2.08