SCOPe 2.04: Domain d3lvdb_: 3lvd B:

Lineage for d3lvdb_ (3lvd B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Aequorea coerulescens [TaxId:210840] [189267] (3 PDB entries)

8. Domain d3lvdb_: 3lvd B: [180590]
   automated match to d1qyoa_
   complexed with gol

Details for d3lvdb_

PDB Entry: 3lvd, 1.75 Å

PDB Description: crystal structure of gfp-like protein acegfp_g222e (a. coerulescens). uv-photoconverted green form.

PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d3lvdb_:

Sequence; same for both SEQRES and ATOM records:

>d3lvdb_ d.22.1.1 (B:) automated matches {Aequorea coerulescens [TaxId: 210840]}
mskgaelftgivpilielngdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
vttlsygvqcfsrypdhmkqhdffksampegyiqertiffeddgnyksraevkfegdtlv
nrieltgtdfkedgnilgnkmeynynahnvyimtdkakngikvnfkirhniedgsvqlad
hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmiyfefvtaaai

Timeline for d3lvdb_:

• d3lvdb_ first appeared in SCOPe 2.01
  
• d3lvdb_ appears in SCOPe 2.03
  
• d3lvdb_ appears in SCOPe 2.05
  
• d3lvdb_ appears in the current release, SCOPe 2.08