Lineage for d3lvca_ (3lvc A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021948Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1021949Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1021950Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1022143Protein automated matches [190406] (14 species)
    not a true protein
  7. 1022144Species Aequorea coerulescens [TaxId:210840] [189267] (3 PDB entries)
  8. 1022145Domain d3lvca_: 3lvc A: [180587]
    automated match to d1qyoa_
    complexed with gol

Details for d3lvca_

PDB Entry: 3lvc (more details), 1.14 Å

PDB Description: crystal structure of gfp-like protein acegfp_g222e (a. coerulescens). colorless form.
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d3lvca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lvca_ d.22.1.1 (A:) automated matches {Aequorea coerulescens [TaxId: 210840]}
mskgaelftgivpilielngdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
vttlsygvqcfsrypdhmkqhdffksampegyiqertiffeddgnyksraevkfegdtlv
nrieltgtdfkedgnilgnkmeynynahnvyimtdkakngikvnfkirhniedgsvqlad
hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmiyfefvtaaai

SCOPe Domain Coordinates for d3lvca_:

Click to download the PDB-style file with coordinates for d3lvca_.
(The format of our PDB-style files is described here.)

Timeline for d3lvca_: