Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (14 species) not a true protein |
Species Aequorea coerulescens [TaxId:210840] [189267] (3 PDB entries) |
Domain d3lvab_: 3lva B: [180586] automated match to d1qyoa_ complexed with gol, so4 |
PDB Entry: 3lva (more details), 1.5 Å
SCOPe Domain Sequences for d3lvab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lvab_ d.22.1.1 (B:) automated matches {Aequorea coerulescens [TaxId: 210840]} skgaelftgivpilielngdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv ttlsygvqcfsrypdhmkqhdffksampegyiqertiffeddgnyksraevkfegdtlvn rieltgtdfkedgnilgnkmeynynahnvyimtdkakngikvnfkirhniedgsvqladh yqqntpigdgpvllpdnhylstqsalskdpnekrdhmiyfgfvtaaaithgmdelyk
Timeline for d3lvab_: