Lineage for d3lvab_ (3lva B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021948Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1021949Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1021950Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1022143Protein automated matches [190406] (14 species)
    not a true protein
  7. 1022144Species Aequorea coerulescens [TaxId:210840] [189267] (3 PDB entries)
  8. 1022148Domain d3lvab_: 3lva B: [180586]
    automated match to d1qyoa_
    complexed with gol, so4

Details for d3lvab_

PDB Entry: 3lva (more details), 1.5 Å

PDB Description: crystal structure of colorless gfp-like protein from aequorea coerulescens
PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d3lvab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lvab_ d.22.1.1 (B:) automated matches {Aequorea coerulescens [TaxId: 210840]}
skgaelftgivpilielngdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlsygvqcfsrypdhmkqhdffksampegyiqertiffeddgnyksraevkfegdtlvn
rieltgtdfkedgnilgnkmeynynahnvyimtdkakngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmiyfgfvtaaaithgmdelyk

SCOPe Domain Coordinates for d3lvab_:

Click to download the PDB-style file with coordinates for d3lvab_.
(The format of our PDB-style files is described here.)

Timeline for d3lvab_: